Recombinant Full Length Human EDC3 Protein, C-Flag-tagged
Cat.No. : | EDC3-533HFL |
Product Overview : | Recombinant Full Length Human EDC3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG INYHSPFGCKFVIPLHSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | RNA degradation |
Full Length : | Full L. |
Gene Name | EDC3 enhancer of mRNA decapping 3 [ Homo sapiens (human) ] |
Official Symbol | EDC3 |
Synonyms | YJDC; LSM16; MRT50; YJEFN2; hYjeF_N2-15q23 |
Gene ID | 80153 |
mRNA Refseq | NM_025083.5 |
Protein Refseq | NP_079359.2 |
MIM | 609842 |
UniProt ID | Q96F86 |
◆ Recombinant Proteins | ||
EDC3-2641Z | Recombinant Zebrafish EDC3 | +Inquiry |
EDC3-6554H | Recombinant Human EDC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EDC3-801H | Recombinant Human EDC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDC3-2245C | Recombinant Chicken EDC3 | +Inquiry |
EDC3-3501H | Recombinant Human EDC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDC3-6726HCL | Recombinant Human EDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDC3 Products
Required fields are marked with *
My Review for All EDC3 Products
Required fields are marked with *
0
Inquiry Basket