Recombinant Full Length Human EDN2 Protein, GST-tagged
| Cat.No. : | EDN2-4192HF |
| Product Overview : | Human EDN2 full-length ORF ( AAH34393, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 178 amino acids |
| Description : | This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
| Molecular Mass : | 45.32 kDa |
| AA Sequence : | MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EDN2 endothelin 2 [ Homo sapiens ] |
| Official Symbol | EDN2 |
| Synonyms | EDN2; endothelin 2; endothelin-2; ET2; ET-2; preproendothelin 2; preproendothelin-2; PPET2; |
| Gene ID | 1907 |
| mRNA Refseq | NM_001956 |
| Protein Refseq | NP_001947 |
| MIM | 131241 |
| UniProt ID | P20800 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDN2 Products
Required fields are marked with *
My Review for All EDN2 Products
Required fields are marked with *




