Recombinant Full Length Human EDN2 Protein, GST-tagged

Cat.No. : EDN2-4192HF
Product Overview : Human EDN2 full-length ORF ( AAH34393, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 178 amino acids
Description : This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Molecular Mass : 45.32 kDa
AA Sequence : MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EDN2 endothelin 2 [ Homo sapiens ]
Official Symbol EDN2
Synonyms EDN2; endothelin 2; endothelin-2; ET2; ET-2; preproendothelin 2; preproendothelin-2; PPET2;
Gene ID 1907
mRNA Refseq NM_001956
Protein Refseq NP_001947
MIM 131241
UniProt ID P20800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDN2 Products

Required fields are marked with *

My Review for All EDN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon