Recombinant Full Length Human EEF1AKMT3 Protein, GST-tagged
Cat.No. : | EEF1AKMT3-4492HF |
Product Overview : | Human FAM119B full-length ORF ( NP_056248.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 226 amino acids |
Description : | EEF1AKMT3 (EEF1A Lysine Methyltransferase 3) is a Protein Coding gene. An important paralog of this gene is METTL21A. |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EEF1AKMT3 EEF1A lysine methyltransferase 3 [ Homo sapiens (human) ] |
Official Symbol | EEF1AKMT3 |
Synonyms | EEF1AKMT3; EEF1A lysine methyltransferase 3; EEF1A Lysine Methyltransferase 3; Methyltransferase Like 21B; METTL21B; Hepatocellular Carcinoma-Associated Antigen 557a; Family With Sequence Similarity 119, Member B; Methyltransferase-Like Protein 21B; FAM119B; Hepatocellularcarcinoma-Associated Antigen HCA557a; Protein-Lysine Methyltransferase METTL21B; EC 2.1.1.-; HCA557A; EEF1A lysine methyltransferase 3; family with sequence similarity 119, member B; hepatocellular carcinoma-associated antigen 557a; hepatocellularcarcinoma-associated antigen HCA557a; methyltransferase like 21B; methyltransferase-like protein 21B; protein-lysine methyltransferase METTL21B |
Gene ID | 25895 |
mRNA Refseq | NM_015433 |
Protein Refseq | NP_056248 |
MIM | 615258 |
UniProt ID | Q96AZ1 |
◆ Recombinant Proteins | ||
EEF1AKMT3-3686H | Recombinant Human EEF1AKMT3 Protein, GST-tagged | +Inquiry |
EEF1AKMT3-4492HF | Recombinant Full Length Human EEF1AKMT3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1AKMT3 Products
Required fields are marked with *
My Review for All EEF1AKMT3 Products
Required fields are marked with *