Recombinant Full Length Human EEF1AKMT3 Protein, GST-tagged

Cat.No. : EEF1AKMT3-4492HF
Product Overview : Human FAM119B full-length ORF ( NP_056248.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 226 amino acids
Description : EEF1AKMT3 (EEF1A Lysine Methyltransferase 3) is a Protein Coding gene. An important paralog of this gene is METTL21A.
Molecular Mass : 51.3 kDa
AA Sequence : MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EEF1AKMT3 EEF1A lysine methyltransferase 3 [ Homo sapiens (human) ]
Official Symbol EEF1AKMT3
Synonyms EEF1AKMT3; EEF1A lysine methyltransferase 3; EEF1A Lysine Methyltransferase 3; Methyltransferase Like 21B; METTL21B; Hepatocellular Carcinoma-Associated Antigen 557a; Family With Sequence Similarity 119, Member B; Methyltransferase-Like Protein 21B; FAM119B; Hepatocellularcarcinoma-Associated Antigen HCA557a; Protein-Lysine Methyltransferase METTL21B; EC 2.1.1.-; HCA557A; EEF1A lysine methyltransferase 3; family with sequence similarity 119, member B; hepatocellular carcinoma-associated antigen 557a; hepatocellularcarcinoma-associated antigen HCA557a; methyltransferase like 21B; methyltransferase-like protein 21B; protein-lysine methyltransferase METTL21B
Gene ID 25895
mRNA Refseq NM_015433
Protein Refseq NP_056248
MIM 615258
UniProt ID Q96AZ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEF1AKMT3 Products

Required fields are marked with *

My Review for All EEF1AKMT3 Products

Required fields are marked with *

0
cart-icon