Recombinant Human EEF1AKMT3 Protein, GST-tagged

• Cat.No.: EEF1AKMT3-3686H
• Product Overview: Human FAM119B full-length ORF ( NP_056248.2, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EEF1AKMT3 (EEF1A Lysine Methyltransferase 3) is a Protein Coding gene. An important paralog of this gene is METTL21A.
• Molecular Mass: 51.3 kDa
• AA Sequence: MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EEF1AKMT3 EEF1A lysine methyltransferase 3 [ Homo sapiens (human) ]
• Official Symbol: EEF1AKMT3
• Synonyms: EEF1AKMT3; EEF1A lysine methyltransferase 3; EEF1A Lysine Methyltransferase 3; Methyltransferase Like 21B; METTL21B; Hepatocellular Carcinoma-Associated Antigen 557a; Family With Sequence Similarity 119, Member B; Methyltransferase-Like Protein 21B; FAM119B; Hepatocellularcarcinoma-Associated Antigen HCA557a; Protein-Lysine Methyltransferase METTL21B; EC 2.1.1.-; HCA557A; EEF1A lysine methyltransferase 3; family with sequence similarity 119, member B; hepatocellular carcinoma-associated antigen 557a; hepatocellularcarcinoma-associated antigen HCA557a; methyltransferase like 21B; methyltransferase-like protein 21B; protein-lysine methyltransferase METTL21B
• Gene ID: 25895
• mRNA Refseq: NM_015433
• Protein Refseq: NP_056248
• MIM: 615258
• UniProt ID: Q96AZ1