Recombinant Full Length Human EEF1B2 Protein, GST-tagged
Cat.No. : | EEF1B2-4207HF |
Product Overview : | Human EEF1B2 full-length ORF ( AAH00211, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 225 amino acids |
Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.49 kDa |
AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens ] |
Official Symbol | EEF1B2 |
Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
Gene ID | 1933 |
mRNA Refseq | NM_001037663 |
Protein Refseq | NP_001032752 |
MIM | 600655 |
UniProt ID | P24534 |
◆ Recombinant Proteins | ||
EEF1B2-365H | Recombinant Human EEF1B2 protein, His-tagged | +Inquiry |
EEF1B2-5455H | Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EEF1B2-10315Z | Recombinant Zebrafish EEF1B2 | +Inquiry |
EEF1B2-1208R | Recombinant Rhesus Macaque EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1B2-4000H | Recombinant Human EEF1B2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *
0
Inquiry Basket