Recombinant Full Length Human EEF1G Protein, GST-tagged
Cat.No. : | EEF1G-4210HF |
Product Overview : | Human EEF1G full-length ORF ( AAH15813.1, 1 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 437 amino acids |
Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 73.59 kDa |
AA Sequence : | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens ] |
Official Symbol | EEF1G |
Synonyms | EEF1G; eukaryotic translation elongation factor 1 gamma; elongation factor 1-gamma; EF1G; PRO1608; EF-1-gamma; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain; GIG35; |
Gene ID | 1937 |
mRNA Refseq | NM_001404 |
Protein Refseq | NP_001395 |
MIM | 130593 |
UniProt ID | P26641 |
◆ Recombinant Proteins | ||
EEF1G-4210HF | Recombinant Full Length Human EEF1G Protein, GST-tagged | +Inquiry |
EEF1G-9535Z | Recombinant Zebrafish EEF1G | +Inquiry |
EEF1G-4222C | Recombinant Chicken EEF1G | +Inquiry |
EEF1G-1673R | Recombinant Rat EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1G-1210R | Recombinant Rhesus Macaque EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *
0
Inquiry Basket