Recombinant Full Length Human EFCAB1 Protein, GST-tagged

Cat.No. : EFCAB1-4222HF
Product Overview : Human EFCAB1 full-length ORF ( NP_078869.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211 amino acids
Description : EFCAB1 (EF-Hand Calcium Binding Domain 1) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding.
Molecular Mass : 50.9 kDa
AA Sequence : MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFCAB1 EF-hand calcium binding domain 1 [ Homo sapiens ]
Official Symbol EFCAB1
Synonyms EFCAB1; EF-hand calcium binding domain 1; EF-Hand Calcium Binding Domain 1; EF-hand calcium-binding domain-containing protein 1
Gene ID 79645
mRNA Refseq NM_024593
Protein Refseq NP_078869
MIM 619564
UniProt ID Q9HAE3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFCAB1 Products

Required fields are marked with *

My Review for All EFCAB1 Products

Required fields are marked with *

0
cart-icon