Recombinant Full Length Human EFCAB1 Protein, GST-tagged
Cat.No. : | EFCAB1-4222HF |
Product Overview : | Human EFCAB1 full-length ORF ( NP_078869.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | EFCAB1 (EF-Hand Calcium Binding Domain 1) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFCAB1 EF-hand calcium binding domain 1 [ Homo sapiens ] |
Official Symbol | EFCAB1 |
Synonyms | EFCAB1; EF-hand calcium binding domain 1; EF-Hand Calcium Binding Domain 1; EF-hand calcium-binding domain-containing protein 1 |
Gene ID | 79645 |
mRNA Refseq | NM_024593 |
Protein Refseq | NP_078869 |
MIM | 619564 |
UniProt ID | Q9HAE3 |
◆ Recombinant Proteins | ||
EFCAB1-12298H | Recombinant Human EFCAB1, GST-tagged | +Inquiry |
EFCAB1-2653M | Recombinant Mouse EFCAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFCAB1-1212R | Recombinant Rhesus Macaque EFCAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFCAB1-3079H | Recombinant Human EFCAB1 Protein, GST-tagged | +Inquiry |
Efcab1-2741M | Recombinant Mouse Efcab1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFCAB1-6710HCL | Recombinant Human EFCAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFCAB1 Products
Required fields are marked with *
My Review for All EFCAB1 Products
Required fields are marked with *
0
Inquiry Basket