Recombinant Full Length Human EFCAB3 Protein, GST-tagged
| Cat.No. : | EFCAB3-4176HF |
| Product Overview : | Human EFCAB3 full-length ORF (BAC05376.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 438 amino acids |
| Description : | EFCAB3 (EF-Hand Calcium Binding Domain 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is SPATA21. |
| Molecular Mass : | 76.5 kDa |
| AA Sequence : | MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKRTLKPDICTPPSSSMAAFANAARIATMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPNVDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNIFTIDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGMDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSECYTDSGRKRKRKGLKGFQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFCAB3 EF-hand calcium binding domain 3 [ Homo sapiens ] |
| Official Symbol | EFCAB3 |
| Synonyms | EFCAB3; EF-hand calcium binding domain 3; EF-hand calcium-binding domain-containing protein 3; FLJ25818; MGC126801; MGC126827; |
| Gene ID | 146779 |
| mRNA Refseq | NM_001144933 |
| Protein Refseq | NP_001138405 |
| MIM | 619567 |
| UniProt ID | Q8N7B9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFCAB3 Products
Required fields are marked with *
My Review for All EFCAB3 Products
Required fields are marked with *
