Recombinant Full Length Human EFCAB3 Protein, GST-tagged
Cat.No. : | EFCAB3-4176HF |
Product Overview : | Human EFCAB3 full-length ORF (BAC05376.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 438 amino acids |
Description : | EFCAB3 (EF-Hand Calcium Binding Domain 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is SPATA21. |
Molecular Mass : | 76.5 kDa |
AA Sequence : | MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKRTLKPDICTPPSSSMAAFANAARIATMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPNVDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNIFTIDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGMDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSECYTDSGRKRKRKGLKGFQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFCAB3 EF-hand calcium binding domain 3 [ Homo sapiens ] |
Official Symbol | EFCAB3 |
Synonyms | EFCAB3; EF-hand calcium binding domain 3; EF-hand calcium-binding domain-containing protein 3; FLJ25818; MGC126801; MGC126827; |
Gene ID | 146779 |
mRNA Refseq | NM_001144933 |
Protein Refseq | NP_001138405 |
MIM | 619567 |
UniProt ID | Q8N7B9 |
◆ Recombinant Proteins | ||
EFCAB3-3081H | Recombinant Human EFCAB3 Protein, GST-tagged | +Inquiry |
EFCAB3-1678R | Recombinant Rat EFCAB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFCAB3-4176HF | Recombinant Full Length Human EFCAB3 Protein, GST-tagged | +Inquiry |
EFCAB3-2021R | Recombinant Rat EFCAB3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFCAB3-6709HCL | Recombinant Human EFCAB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFCAB3 Products
Required fields are marked with *
My Review for All EFCAB3 Products
Required fields are marked with *