Recombinant Full Length Human EFHC1 Protein, C-Flag-tagged
Cat.No. : | EFHC1-1729HFL |
Product Overview : | Recombinant Full Length Human EFHC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.8 kDa |
AA Sequence : | MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAP VLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVEN SGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALD PYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHE RNDGIDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPF TRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDF FIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELE ALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKIN YYNFVRAFSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EFHC1 EF-hand domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | EFHC1 |
Synonyms | EJM1; POC9; RIB72; dJ304B14.2 |
Gene ID | 114327 |
mRNA Refseq | NM_018100.4 |
Protein Refseq | NP_060570.2 |
MIM | 608815 |
UniProt ID | Q5JVL4 |
◆ Recombinant Proteins | ||
EFHC1-4211HF | Recombinant Full Length Human EFHC1 Protein, GST-tagged | +Inquiry |
Efhc1-2750M | Recombinant Mouse Efhc1 Protein, Myc/DDK-tagged | +Inquiry |
EFHC1-1731H | Recombinant Human EFHC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EFHC1-11202Z | Recombinant Zebrafish EFHC1 | +Inquiry |
EFHC1-1729HFL | Recombinant Full Length Human EFHC1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFHC1-6701HCL | Recombinant Human EFHC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFHC1 Products
Required fields are marked with *
My Review for All EFHC1 Products
Required fields are marked with *
0
Inquiry Basket