Recombinant Full Length Human EFHC2 Protein, GST-tagged
| Cat.No. : | EFHC2-4212HF |
| Product Overview : | Human EFHC2 full-length ORF ( NP_079460.2, 1 a.a. - 749 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 749 amino acids |
| Description : | This gene encodes a protein which contains three DM10 domains and three calcium-binding EF-hand motifs. A related protein is encoded by a gene on chromosome 6. It has been suggested that both proteins are involved in the development of epilepsy (PMID: 15258581, 16112844) and that this gene may be associated with fear recognition in individuals with Turner syndrome. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 113.8 kDa |
| AA Sequence : | MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFKKFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQEEGKSRELKQVFKAADSKHTNMVDYNTFRDILMSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSRFEDSEKQIDYKSFFSALNWRKNPVPELQPASYLKERCEDVWLGMPSPIPAKYIDYWTFLKDAFGLEEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFHC2 EF-hand domain (C-terminal) containing 2 [ Homo sapiens ] |
| Official Symbol | EFHC2 |
| Synonyms | EFHC2; EF-hand domain (C-terminal) containing 2; EF-hand domain-containing family member C2; FLJ22843; dJ1158H2.1; FLJ22601; DKFZp686G08235; |
| Gene ID | 80258 |
| mRNA Refseq | NM_025184 |
| Protein Refseq | NP_079460 |
| MIM | 300817 |
| UniProt ID | Q5JST6 |
| ◆ Recombinant Proteins | ||
| EFHC2-4212HF | Recombinant Full Length Human EFHC2 Protein, GST-tagged | +Inquiry |
| EFHC2-3092H | Recombinant Human EFHC2 Protein, GST-tagged | +Inquiry |
| EFHC2-3520Z | Recombinant Zebrafish EFHC2 | +Inquiry |
| EFHC2-3298C | Recombinant Chicken EFHC2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFHC2-535HCL | Recombinant Human EFHC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHC2 Products
Required fields are marked with *
My Review for All EFHC2 Products
Required fields are marked with *
