Recombinant Full Length Human EGFL7 Protein, C-Flag-tagged
Cat.No. : | EGFL7-1545HFL |
Product Overview : | Recombinant Full Length Human EGFL7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ] |
Official Symbol | EGFL7 |
Synonyms | NEU1; ZNEU1; VE-STATIN |
Gene ID | 51162 |
mRNA Refseq | NM_016215.5 |
Protein Refseq | NP_057299.1 |
MIM | 608582 |
UniProt ID | Q9UHF1 |
◆ Recombinant Proteins | ||
EGFL7-1395R | Recombinant Rhesus monkey EGFL7 Protein, His-tagged | +Inquiry |
EGFL7-1694H | Recombinant Human EGFL7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EGFL7-4256HF | Recombinant Full Length Human EGFL7 Protein, GST-tagged | +Inquiry |
EGFL7-2127H | Recombinant Human EGFL7 Protein (Tyr24-Ser273), N-His tagged | +Inquiry |
EGFL7-3077H | Active Recombinant Human EGFL7 protein(Tyr24-Ser273), His-tagged | +Inquiry |
◆ Native Proteins | ||
EGFL7-001H | Recombinant Human EGFL7 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFL7-649HCL | Recombinant Human EGFL7 cell lysate | +Inquiry |
EGFL7-565MCL | Recombinant Mouse EGFL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL7 Products
Required fields are marked with *
My Review for All EGFL7 Products
Required fields are marked with *