Recombinant Full Length Human EGLN3 Protein, GST-tagged

Cat.No. : EGLN3-4262HF
Product Overview : Human EGLN3 full-length ORF ( NP_071356.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 239 amino acids
Description : EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3) is a Protein Coding gene. Diseases associated with EGLN3 include Hypoxia and Chronic Mountain Sickness. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Development HGF signaling pathway. GO annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is EGLN2.
Molecular Mass : 53.7 kDa
AA Sequence : MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EGLN3 egl nine homolog 3 (C. elegans) [ Homo sapiens ]
Official Symbol EGLN3
Synonyms EGLN3; egl nine homolog 3 (C. elegans); EGL nine (C.elegans) homolog 3; egl nine homolog 3; HIF prolyl hydroxylase 3; HIFPH3; PHD3; HPH-1; HPH-3; HIF-PH3; HIF-prolyl hydroxylase 3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3; FLJ21620; MGC125998; MGC125999;
Gene ID 112399
mRNA Refseq NM_022073
Protein Refseq NP_071356
MIM 606426
UniProt ID Q9H6Z9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGLN3 Products

Required fields are marked with *

My Review for All EGLN3 Products

Required fields are marked with *

0
cart-icon