Recombinant Full Length Human EHD1 Protein, GST-tagged
| Cat.No. : | EHD1-4316HF | 
| Product Overview : | Human EHD1 full-length ORF (1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 317 amino acids | 
| Description : | This gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The protein encoded by this gene is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2013] | 
| Molecular Mass : | 62.6 kDa | 
| AA Sequence : | MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPFGHGYGEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | EHD1 EH-domain containing 1 [ Homo sapiens ] | 
| Official Symbol | EHD1 | 
| Synonyms | EHD1; EH-domain containing 1; PAST1; EH domain-containing protein 1; FLJ42622; FLJ44618; H PAST; HPAST1; testilin; PAST homolog 1; PAST; H-PAST; | 
| Gene ID | 10938 | 
| mRNA Refseq | NM_006795 | 
| Protein Refseq | NP_006786 | 
| MIM | 605888 | 
| UniProt ID | Q9H4M9 | 
| ◆ Recombinant Proteins | ||
| EHD1-813H | Recombinant Human EHD1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| EHD1-12332H | Recombinant Human EHD1, GST-tagged | +Inquiry | 
| EHD1-2036R | Recombinant Rat EHD1 Protein | +Inquiry | 
| EHD1-1494HFL | Recombinant Full Length Human EHD1 Protein, C-Flag-tagged | +Inquiry | 
| EHD1-3128H | Recombinant Human EHD1 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EHD1 Products
Required fields are marked with *
My Review for All EHD1 Products
Required fields are marked with *
  
        
    
      
            