Recombinant Full Length Human EHD2 Protein, C-Flag-tagged
Cat.No. : | EHD2-2173HFL |
Product Overview : | Recombinant Full Length Human EHD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the EH domain-containing protein family. These proteins are characterized by a C-terminal EF-hand domain, a nucleotide-binding consensus site at the N terminus and a bipartite nuclear localization signal. The encoded protein interacts with the actin cytoskeleton through an N-terminal domain and also binds to an EH domain-binding protein through the C-terminal EH domain. This interaction appears to connect clathrin-dependent endocytosis to actin, suggesting that this gene product participates in the endocytic pathway. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61 kDa |
AA Sequence : | MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPMVLVAGQYSTG KTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDKPFRKLNPFGNTFLNRFMCAQ LPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGH EDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFR DIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISP GDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIW KLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | EHD2 EH domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | EHD2 |
Synonyms | PAST2 |
Gene ID | 30846 |
mRNA Refseq | NM_014601.4 |
Protein Refseq | NP_055416.2 |
MIM | 605890 |
UniProt ID | Q9NZN4 |
◆ Recombinant Proteins | ||
EHD2-2686M | Recombinant Mouse EHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHD2-5058M | Recombinant Mouse EHD2 Protein | +Inquiry |
EHD2-814H | Recombinant Human EHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHD2-1694R | Recombinant Rat EHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHD2-4320HF | Recombinant Full Length Human EHD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EHD2-6690HCL | Recombinant Human EHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EHD2 Products
Required fields are marked with *
My Review for All EHD2 Products
Required fields are marked with *
0
Inquiry Basket