Recombinant Full Length Human EID2B Protein, C-Flag-tagged
Cat.No. : | EID2B-2079HFL |
Product Overview : | Recombinant Full Length Human EID2B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Involved in negative regulation of myoblast differentiation and negative regulation of transcription, DNA-templated. Located in nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPS SVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMD FAAVAFTVALTASEALSPLAD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EID2B EP300 interacting inhibitor of differentiation 2B [ Homo sapiens (human) ] |
Official Symbol | EID2B |
Synonyms | EID-3; EID-2B |
Gene ID | 126272 |
mRNA Refseq | NM_152361.3 |
Protein Refseq | NP_689574.1 |
MIM | 617355 |
UniProt ID | Q96D98 |
◆ Recombinant Proteins | ||
EID2B-2584H | Recombinant Human EID2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EID2B-1409R | Recombinant Rhesus monkey EID2B Protein, His-tagged | +Inquiry |
EID2B-12341H | Recombinant Human EID2B, His-tagged | +Inquiry |
EID2B-396H | Recombinant Human EID2B Protein, MYC/DDK-tagged | +Inquiry |
EID2B-3139H | Recombinant Human EID2B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EID2B-6681HCL | Recombinant Human EID2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EID2B Products
Required fields are marked with *
My Review for All EID2B Products
Required fields are marked with *
0
Inquiry Basket