Recombinant Full Length Human EID2B Protein, C-Flag-tagged
| Cat.No. : | EID2B-2079HFL | 
| Product Overview : | Recombinant Full Length Human EID2B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Enables identical protein binding activity. Involved in negative regulation of myoblast differentiation and negative regulation of transcription, DNA-templated. Located in nucleus. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 16.8 kDa | 
| AA Sequence : | MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPS SVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMD FAAVAFTVALTASEALSPLAD myc-FLAG tag | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Full Length : | Full L. | 
| Gene Name | EID2B EP300 interacting inhibitor of differentiation 2B [ Homo sapiens (human) ] | 
| Official Symbol | EID2B | 
| Synonyms | EID-3; EID-2B | 
| Gene ID | 126272 | 
| mRNA Refseq | NM_152361.3 | 
| Protein Refseq | NP_689574.1 | 
| MIM | 617355 | 
| UniProt ID | Q96D98 | 
| ◆ Recombinant Proteins | ||
| EID2B-12341H | Recombinant Human EID2B, His-tagged | +Inquiry | 
| EID2B-1409R | Recombinant Rhesus monkey EID2B Protein, His-tagged | +Inquiry | 
| EID2B-396H | Recombinant Human EID2B Protein, MYC/DDK-tagged | +Inquiry | 
| EID2B-3139H | Recombinant Human EID2B Protein, GST-tagged | +Inquiry | 
| EID2B-2584H | Recombinant Human EID2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EID2B-6681HCL | Recombinant Human EID2B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EID2B Products
Required fields are marked with *
My Review for All EID2B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            