Recombinant Full Length Human EIF3J Protein, GST-tagged

Cat.No. : EIF3J-4276HF
Product Overview : Human EIF3S1 full-length ORF ( NP_003749.2, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 258 amino acids
Description : This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chromosomes 1, 3, and 9. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
Molecular Mass : 55.5 kDa
AA Sequence : MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF3J eukaryotic translation initiation factor 3, subunit J [ Homo sapiens ]
Official Symbol EIF3J
Synonyms EIF3J; eukaryotic translation initiation factor 3, subunit J; EIF3S1, eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3 subunit J; eIF3 alpha; eIF3 p35; eIF3j; eIF-3-alpha; eukaryotic translation initiation factor 3 subunit 1; eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD); EIF3S1; eIF3-p35; eIF3-alpha;
Gene ID 8669
mRNA Refseq NM_003758
Protein Refseq NP_003749
MIM 603910
UniProt ID O75822

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3J Products

Required fields are marked with *

My Review for All EIF3J Products

Required fields are marked with *

0

Inquiry Basket

cartIcon