Recombinant Full Length Human EIF3J Protein, GST-tagged
Cat.No. : | EIF3J-4276HF |
Product Overview : | Human EIF3S1 full-length ORF ( NP_003749.2, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 258 amino acids |
Description : | This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chromosomes 1, 3, and 9. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF3J eukaryotic translation initiation factor 3, subunit J [ Homo sapiens ] |
Official Symbol | EIF3J |
Synonyms | EIF3J; eukaryotic translation initiation factor 3, subunit J; EIF3S1, eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3 subunit J; eIF3 alpha; eIF3 p35; eIF3j; eIF-3-alpha; eukaryotic translation initiation factor 3 subunit 1; eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD); EIF3S1; eIF3-p35; eIF3-alpha; |
Gene ID | 8669 |
mRNA Refseq | NM_003758 |
Protein Refseq | NP_003749 |
MIM | 603910 |
UniProt ID | O75822 |
◆ Recombinant Proteins | ||
EIF3J-3189H | Recombinant Human EIF3J Protein, GST-tagged | +Inquiry |
EIF3J-1424R | Recombinant Rhesus monkey EIF3J Protein, His-tagged | +Inquiry |
EIF3J-1720R | Recombinant Rat EIF3J Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3J-12371H | Recombinant Human EIF3J, GST-tagged | +Inquiry |
EIF3J-2001C | Recombinant Chicken EIF3J | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3J-6657HCL | Recombinant Human EIF3J 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3J Products
Required fields are marked with *
My Review for All EIF3J Products
Required fields are marked with *
0
Inquiry Basket