Recombinant Full Length Human EIF4B Protein, C-Flag-tagged
| Cat.No. : | EIF4B-652HFL |
| Product Overview : | Recombinant Full Length Human EIF4B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables RNA binding activity. Predicted to be involved in eukaryotic translation initiation factor 4F complex assembly and formation of translation preinitiation complex. Located in cytosol. Biomarker of autism spectrum disorder and major depressive disorder. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 69 kDa |
| AA Sequence : | MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDR SILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFG YAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDD YPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSN PPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | mTOR signaling pathway |
| Full Length : | Full L. |
| Gene Name | EIF4B eukaryotic translation initiation factor 4B [ Homo sapiens (human) ] |
| Official Symbol | EIF4B |
| Synonyms | EIF-4B; PRO1843 |
| Gene ID | 1975 |
| mRNA Refseq | NM_001417.7 |
| Protein Refseq | NP_001408.2 |
| MIM | 603928 |
| UniProt ID | P23588 |
| ◆ Recombinant Proteins | ||
| EIF4B-828H | Recombinant Human EIF4B Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF4B-4286HF | Recombinant Full Length Human EIF4B Protein, GST-tagged | +Inquiry |
| EIF4B-5105M | Recombinant Mouse EIF4B Protein | +Inquiry |
| EIF4B-27411TH | Recombinant Human EIF4B | +Inquiry |
| EIF4B-3197H | Recombinant Human EIF4B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4B Products
Required fields are marked with *
My Review for All EIF4B Products
Required fields are marked with *
