Recombinant Full Length Human EIF4EBP3 Protein, GST-tagged

Cat.No. : EIF4EBP3-4296HF
Product Overview : Human EIF4EBP3 full-length ORF ( AAH10881, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 100 amino acids
Description : This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]
Molecular Mass : 36.74 kDa
AA Sequence : MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ]
Official Symbol EIF4EBP3
Synonyms EIF4EBP3; eukaryotic translation initiation factor 4E binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3; 4E BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; 4EBP3; 4E-BP3;
Gene ID 8637
mRNA Refseq NM_003732
Protein Refseq NP_003723
MIM 603483
UniProt ID O60516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP3 Products

Required fields are marked with *

My Review for All EIF4EBP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon