Recombinant Full Length Human ELF3 Protein, GST-tagged
Cat.No. : | ELF3-4348HF |
Product Overview : | Human ELF3 full-length ORF ( AAH03569.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 371 amino acids |
Description : | ELF3 (E74 Like ETS Transcription Factor 3) is a Protein Coding gene. Diseases associated with ELF3 include Sarcoma, Synovial and Growth Hormone Deficiency, Isolated, Type Ii. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription coactivator activity. An important paralog of this gene is EHF. |
Molecular Mass : | 67.9 kDa |
AA Sequence : | MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ] |
Official Symbol | ELF3 |
Synonyms | ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; epithelial-restricted with serine box; epithelium-restricted Ets protein ESX; epithelium-specific Ets transcription factor 1; E74-like factor 3 (ets domain transcription factor); ets domain transcription factor, serine box (epithelial-specific); E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific); EPR-1; ESE-1; |
Gene ID | 1999 |
mRNA Refseq | NM_001114309 |
Protein Refseq | NP_001107781 |
MIM | 602191 |
UniProt ID | P78545 |
◆ Recombinant Proteins | ||
ELF3-3240H | Recombinant Human ELF3 Protein, GST-tagged | +Inquiry |
ELF3-4348HF | Recombinant Full Length Human ELF3 Protein, GST-tagged | +Inquiry |
ELF3-5215H | Recombinant Human ELF3 protein | +Inquiry |
ELF3-2074R | Recombinant Rat ELF3 Protein | +Inquiry |
ELF3-5214H | Recombinant Human ELF3 protein, Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF3-6632HCL | Recombinant Human ELF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF3 Products
Required fields are marked with *
My Review for All ELF3 Products
Required fields are marked with *