Recombinant Full Length Human EMC8 Protein, GST-tagged
| Cat.No. : | EMC8-2005HF |
| Product Overview : | Human COX4NB full-length ORF ( AAH05886, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 210 amino acids |
| Description : | EMC8 (ER Membrane Protein Complex Subunit 8) is a Protein Coding gene. An important paralog of this gene is EMC9. |
| Molecular Mass : | 48.73 kDa |
| AA Sequence : | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ] |
| Official Symbol | EMC8 |
| Synonyms | EMC8; ER membrane protein complex subunit 8; COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B; family with sequence similarity 158, member B; NOC4; C16orf2; C16orf4 |
| Gene ID | 10328 |
| mRNA Refseq | NM_001142288 |
| Protein Refseq | NP_001135760 |
| MIM | 604886 |
| UniProt ID | O43402 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMC8 Products
Required fields are marked with *
My Review for All EMC8 Products
Required fields are marked with *
