Recombinant Full Length Human EMC8 Protein, GST-tagged

• Cat.No.: EMC8-2005HF
• Product Overview: Human COX4NB full-length ORF ( AAH05886, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 210 amino acids
• Description: EMC8 (ER Membrane Protein Complex Subunit 8) is a Protein Coding gene. An important paralog of this gene is EMC9.
• Molecular Mass: 48.73 kDa
• AA Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ]
• Official Symbol: EMC8
• Synonyms: EMC8; ER membrane protein complex subunit 8; COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B; family with sequence similarity 158, member B; NOC4; C16orf2; C16orf4
• Gene ID: 10328
• mRNA Refseq: NM_001142288
• Protein Refseq: NP_001135760
• MIM: 604886
• UniProt ID: O43402