Recombinant Full Length Human EMC8 Protein, GST-tagged

Cat.No. : EMC8-2005HF
Product Overview : Human COX4NB full-length ORF ( AAH05886, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 210 amino acids
Description : EMC8 (ER Membrane Protein Complex Subunit 8) is a Protein Coding gene. An important paralog of this gene is EMC9.
Molecular Mass : 48.73 kDa
AA Sequence : MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ]
Official Symbol EMC8
Synonyms EMC8; ER membrane protein complex subunit 8; COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B; family with sequence similarity 158, member B; NOC4; C16orf2; C16orf4
Gene ID 10328
mRNA Refseq NM_001142288
Protein Refseq NP_001135760
MIM 604886
UniProt ID O43402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMC8 Products

Required fields are marked with *

My Review for All EMC8 Products

Required fields are marked with *

0
cart-icon