Recombinant Full Length Human EMCN Protein, GST-tagged

Cat.No. : EMCN-4232HF
Product Overview : Human EMCN full-length ORF (BAG36284.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 261 amino acids
Description : EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).[supplied by OMIM, Mar 2008]
Molecular Mass : 55.11 kDa
AA Sequence : MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMCN endomucin [ Homo sapiens ]
Official Symbol EMCN
Synonyms EMCN; endomucin; MUC14; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34; EMCN2;
Gene ID 51705
mRNA Refseq NM_001159694
Protein Refseq NP_001153166
MIM 608350
UniProt ID Q9ULC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMCN Products

Required fields are marked with *

My Review for All EMCN Products

Required fields are marked with *

0
cart-icon
0
compare icon