Recombinant Full Length Human ENO2 Protein, C-Flag-tagged
Cat.No. : | ENO2-171HFL |
Product Overview : | Recombinant Full Length Human ENO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE ARFAGHNFRNPSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Full Length : | Full L. |
Gene Name | ENO2 enolase 2 [ Homo sapiens (human) ] |
Official Symbol | ENO2 |
Synonyms | NSE; HEL-S-279 |
Gene ID | 2026 |
mRNA Refseq | NM_001975.3 |
Protein Refseq | NP_001966.1 |
MIM | 131360 |
UniProt ID | P09104 |
◆ Recombinant Proteins | ||
ENO2-43H | Recombinant Human Enolase 2 (Gamma, Neuronal), His-tagged | +Inquiry |
ENO2-0553M | Active Recombinant Mouse ENO2 protein, His-tagged | +Inquiry |
ENO2-1277H | Recombinant Human Benolase 2 (Gamma, Neuronal) | +Inquiry |
ENO2-108H | Recombinant Human enolase 2, His-tagged | +Inquiry |
Eno2-2762R | Recombinant Rat Eno2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO2-6598HCL | Recombinant Human ENO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENO2 Products
Required fields are marked with *
My Review for All ENO2 Products
Required fields are marked with *
0
Inquiry Basket