Recombinant Full Length Human ENSA Protein, GST-tagged
Cat.No. : | ENSA-4327HF |
Product Overview : | Human ENSA full-length ORF ( AAH00436, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 39.05 kDa |
AA Sequence : | MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ENSA endosulfine alpha [ Homo sapiens ] |
Official Symbol | ENSA |
Synonyms | ENSA; endosulfine alpha; alpha-endosulfine; ARPP 19e; MGC4319; MGC8394; MGC78563; ARPP-19e; |
Gene ID | 2029 |
mRNA Refseq | NM_004436 |
Protein Refseq | NP_004427 |
MIM | 603061 |
UniProt ID | O43768 |
◆ Recombinant Proteins | ||
Ensa-3364M | Recombinant Mouse Ensa, His-tagged | +Inquiry |
ENSA-1710H | Recombinant Human ENSA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENSA-5215M | Recombinant Mouse ENSA Protein | +Inquiry |
ENSA-2108R | Recombinant Rat ENSA Protein | +Inquiry |
ENSA-539H | Recombinant Human ENSA, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENSA-6593HCL | Recombinant Human ENSA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENSA Products
Required fields are marked with *
My Review for All ENSA Products
Required fields are marked with *