Recombinant Full Length Human ENTPD3 Protein, GST-tagged

Cat.No. : ENTPD3-4332HF
Product Overview : Human ENTPD3 full-length ORF ( AAH29869.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 452 amino acids
Description : This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
Molecular Mass : 77.1 kDa
AA Sequence : MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens ]
Official Symbol ENTPD3
Synonyms ENTPD3; ectonucleoside triphosphate diphosphohydrolase 3; CD39L3; HB6; NTPDase 3; CD39-like 3; ecto-ATPase 3; ecto-ATPDase 3; ecto-apyrase 3; CD39 antigen-like 3; ecto-ATP diphosphohydrolase 3; NTPDase-3; FLJ93839;
Gene ID 956
mRNA Refseq NM_001248
Protein Refseq NP_001239
MIM 603161
UniProt ID O75355

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENTPD3 Products

Required fields are marked with *

My Review for All ENTPD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon