Recombinant Full Length Human ENTPD5 Protein, C-Flag-tagged
Cat.No. : | ENTPD5-1575HFL |
Product Overview : | Recombinant Full Length Human ENTPD5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQK MPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHK AKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFL PQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAE WIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGIL KVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHL LQSLGISHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 (inactive) [ Homo sapiens (human) ] |
Official Symbol | ENTPD5 |
Synonyms | PCPH; CD39L4; NTPDase-5 |
Gene ID | 957 |
mRNA Refseq | NM_001249.5 |
Protein Refseq | NP_001240.1 |
MIM | 603162 |
UniProt ID | O75356 |
◆ Cell & Tissue Lysates | ||
ENTPD5-001MCL | Recombinant Mouse ENTPD5 cell lysate | +Inquiry |
ENTPD5-451HCL | Recombinant Human ENTPD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD5 Products
Required fields are marked with *
My Review for All ENTPD5 Products
Required fields are marked with *
0
Inquiry Basket