Recombinant Full Length Human ENTPD6 Protein, C-Flag-tagged
Cat.No. : | ENTPD6-2123HFL |
Product Overview : | Recombinant Full Length Human ENTPD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which are characteristic of NTPases. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MKKGIRYETSRKTSYIFQPQHGPWQTRMRKISNHGSLRVAKVAYPLGLCVGVFIYVAYIKWHRATATQAF FSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPG LSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLV GDDCVSIMNGTDEGVSAWITINFLTGSLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTALR MFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAAS LHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLET QPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Protein Pathways : | Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | ENTPD6 ectonucleoside triphosphate diphosphohydrolase 6 [ Homo sapiens (human) ] |
Official Symbol | ENTPD6 |
Synonyms | CD39L2; IL6ST2; IL-6SAG; NTPDase-6; dJ738P15.3 |
Gene ID | 955 |
mRNA Refseq | NM_001247.5 |
Protein Refseq | NP_001238.3 |
MIM | 603160 |
UniProt ID | O75354 |
◆ Recombinant Proteins | ||
ENTPD6-2123HFL | Recombinant Full Length Human ENTPD6 Protein, C-Flag-tagged | +Inquiry |
Entpd6-837M | Recombinant Mouse Entpd6 Protein, MYC/DDK-tagged | +Inquiry |
ENTPD6-1769R | Recombinant Rat ENTPD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD6-3546H | Recombinant Human ENTPD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENTPD6-3339H | Recombinant Human ENTPD6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD6-6591HCL | Recombinant Human ENTPD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD6 Products
Required fields are marked with *
My Review for All ENTPD6 Products
Required fields are marked with *
0
Inquiry Basket