Recombinant Full Length Human ERH Protein, GST-tagged
| Cat.No. : | ERH-4585HF |
| Product Overview : | Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 104 amino acids |
| Description : | ERH (Enhancer Of Rudimentary Homolog (Drosophila)) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
| Molecular Mass : | 37.18 kDa |
| AA Sequence : | MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ERH |
| Synonyms | ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340; |
| Gene ID | 2079 |
| mRNA Refseq | NM_004450 |
| Protein Refseq | NP_004441 |
| MIM | 601191 |
| UniProt ID | P84090 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERH Products
Required fields are marked with *
My Review for All ERH Products
Required fields are marked with *



