Recombinant Full Length Human ERH Protein, GST-tagged

Cat.No. : ERH-4585HF
Product Overview : Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 104 amino acids
Description : ERH (Enhancer Of Rudimentary Homolog (Drosophila)) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
Molecular Mass : 37.18 kDa
AA Sequence : MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ]
Official Symbol ERH
Synonyms ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340;
Gene ID 2079
mRNA Refseq NM_004450
Protein Refseq NP_004441
MIM 601191
UniProt ID P84090

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERH Products

Required fields are marked with *

My Review for All ERH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon