Recombinant Full Length Human ERMP1 Protein, GST-tagged
| Cat.No. : | ERMP1-4596HF |
| Product Overview : | Human ERMP1 full-length ORF ( AAH31630.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 317 amino acids |
| Description : | ERMP1 (Endoplasmic Reticulum Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and metallopeptidase activity. |
| Molecular Mass : | 62.4 kDa |
| AA Sequence : | MFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVCAITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ] |
| Official Symbol | ERMP1 |
| Synonyms | endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3 |
| Gene ID | 79956 |
| mRNA Refseq | NM_024896 |
| Protein Refseq | NP_079172 |
| MIM | 611156 |
| UniProt ID | B3KSB1 |
| ◆ Recombinant Proteins | ||
| ERMP1-4596HF | Recombinant Full Length Human ERMP1 Protein, GST-tagged | +Inquiry |
| ERMP1-3482H | Recombinant Human ERMP1 Protein, GST-tagged | +Inquiry |
| ERMP1-2856M | Recombinant Mouse ERMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ERMP1-5309M | Recombinant Mouse ERMP1 Protein | +Inquiry |
| ERMP1-2142R | Recombinant Rat ERMP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMP1 Products
Required fields are marked with *
My Review for All ERMP1 Products
Required fields are marked with *
