Recombinant Full Length Human ESD Protein, C-Flag-tagged
Cat.No. : | ESD-1173HFL |
Product Overview : | Recombinant Full Length Human ESD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.3 kDa |
AA Sequence : | MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL NATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ESD esterase D [ Homo sapiens (human) ] |
Official Symbol | ESD |
Synonyms | FGH |
Gene ID | 2098 |
mRNA Refseq | NM_001984.2 |
Protein Refseq | NP_001975.1 |
MIM | 133280 |
UniProt ID | P10768 |
◆ Recombinant Proteins | ||
ESD-1682H | Recombinant Human Esterase D, His-tagged | +Inquiry |
ESD-12554H | Recombinant Human ESD, GST-tagged | +Inquiry |
ESD-2532Z | Recombinant Zebrafish ESD | +Inquiry |
ESD-2863M | Recombinant Mouse ESD Protein, His (Fc)-Avi-tagged | +Inquiry |
ESD-2147R | Recombinant Rat ESD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESD-6541HCL | Recombinant Human ESD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESD Products
Required fields are marked with *
My Review for All ESD Products
Required fields are marked with *
0
Inquiry Basket