Recombinant Full Length Human ETV1 Protein, GST-tagged
Cat.No. : | ETV1-4753HF |
Product Overview : | Human ETV1 full-length ORF ( ABZ92002.1, 1 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 477 amino acids |
Description : | This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETV1 ets variant 1 [ Homo sapiens ] |
Official Symbol | ETV1 |
Synonyms | ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81; ets-related protein 81; MGC104699; MGC120533; MGC120534; DKFZp781L0674; |
Gene ID | 2115 |
mRNA Refseq | NM_001163147 |
Protein Refseq | NP_001156619 |
MIM | 600541 |
UniProt ID | P50549 |
◆ Recombinant Proteins | ||
ETV1-1277H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
ETV1-3531H | Recombinant Human ETV1 Protein, GST-tagged | +Inquiry |
ETV1-1275H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
ETV1-873H | Recombinant Human ETV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV1-6479C | Recombinant Chicken ETV1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV1 Products
Required fields are marked with *
My Review for All ETV1 Products
Required fields are marked with *