Recombinant Full Length Human EVI2A Protein, GST-tagged

Cat.No. : EVI2A-4375HF
Product Overview : Human EVI2A full-length ORF ( AAH35572, 25 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 25-236 amino acids
Description : EVI2A (Ecotropic Viral Integration Site 2A) is a Protein Coding gene. GO annotations related to this gene include transmembrane signaling receptor activity. An important paralog of this gene is ENSG00000265118.
Molecular Mass : 49.06 kDa
AA Sequence : SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EVI2A ecotropic viral integration site 2A [ Homo sapiens ]
Official Symbol EVI2A
Synonyms EVI2A; ecotropic viral integration site 2A; EVI2; protein EVI2A; EVDA; ecotropic viral integration site 2A protein homolog; EVI-2A;
Gene ID 2123
mRNA Refseq NM_001003927
Protein Refseq NP_001003927
MIM 158380
UniProt ID P22794

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EVI2A Products

Required fields are marked with *

My Review for All EVI2A Products

Required fields are marked with *

0
cart-icon