Recombinant Full Length Human EXOSC2 Protein, GST-tagged

Cat.No. : EXOSC2-4427HF
Product Overview : Human EXOSC2 full-length ORF (BAB14043.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : EXOSC2 (Exosome Component 2) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Deadenylation-dependent mRNA decay. GO annotations related to this gene include RNA binding and exoribonuclease activity.
Molecular Mass : 59.2 kDa
AA Sequence : MAMEMRLPVARKPLSERLGRVTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOSC2 exosome component 2 [ Homo sapiens ]
Official Symbol EXOSC2
Synonyms EXOSC2; exosome component 2; exosome complex component RRP4; homolog of yeast RRP4 (ribosomal RNA processing 4); 3 5 exoribonuclease (RRP4); hRrp4p; p7; RRP4; Rrp4p; exosome complex exonuclease RRP4; ribosomal RNA-processing protein 4; homolog of yeast RRP4 (ribosomal RNA processing 4), 3-5-exoribonuclease; homolog of yeast RRP4 (ribosomal RNA processing 4), 3 5 exoribonuclease (RRP4);
Gene ID 23404
mRNA Refseq NM_014285
Protein Refseq NP_055100
MIM 602238
UniProt ID Q13868

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC2 Products

Required fields are marked with *

My Review for All EXOSC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon