Recombinant Full Length Human EXOSC2 Protein, GST-tagged
Cat.No. : | EXOSC2-4427HF |
Product Overview : | Human EXOSC2 full-length ORF (BAB14043.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 293 amino acids |
Description : | EXOSC2 (Exosome Component 2) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Deadenylation-dependent mRNA decay. GO annotations related to this gene include RNA binding and exoribonuclease activity. |
Molecular Mass : | 59.2 kDa |
AA Sequence : | MAMEMRLPVARKPLSERLGRVTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOSC2 exosome component 2 [ Homo sapiens ] |
Official Symbol | EXOSC2 |
Synonyms | EXOSC2; exosome component 2; exosome complex component RRP4; homolog of yeast RRP4 (ribosomal RNA processing 4); 3 5 exoribonuclease (RRP4); hRrp4p; p7; RRP4; Rrp4p; exosome complex exonuclease RRP4; ribosomal RNA-processing protein 4; homolog of yeast RRP4 (ribosomal RNA processing 4), 3-5-exoribonuclease; homolog of yeast RRP4 (ribosomal RNA processing 4), 3 5 exoribonuclease (RRP4); |
Gene ID | 23404 |
mRNA Refseq | NM_014285 |
Protein Refseq | NP_055100 |
MIM | 602238 |
UniProt ID | Q13868 |
◆ Recombinant Proteins | ||
EXOSC2-4427HF | Recombinant Full Length Human EXOSC2 Protein, GST-tagged | +Inquiry |
Exosc2-2890M | Recombinant Mouse Exosc2 Protein, Myc/DDK-tagged | +Inquiry |
EXOSC2-3569H | Recombinant Human EXOSC2 Protein, GST-tagged | +Inquiry |
EXOSC2-2351Z | Recombinant Zebrafish EXOSC2 | +Inquiry |
EXOSC2-2026C | Recombinant Chicken EXOSC2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOSC2-6503HCL | Recombinant Human EXOSC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC2 Products
Required fields are marked with *
My Review for All EXOSC2 Products
Required fields are marked with *