Recombinant Full Length Human F8A2 Protein, C-Flag-tagged
Cat.No. : | F8A2-1753HFL |
Product Overview : | Recombinant Full Length Human F8A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. Although its function is unknown, the observation that this gene is conserved in the mouse implies it has some function. Unlike factor VIII, this gene is transcribed abundantly in a wide variety of cell types. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MAAAAAGLGGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQ LAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAA AAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRL AREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLL QPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTA EQNHLLHLVLQETISPSGQGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | F8A2 coagulation factor VIII associated 2 [ Homo sapiens (human) ] |
Official Symbol | F8A2 |
Synonyms | HAP40 |
Gene ID | 474383 |
mRNA Refseq | NM_001007523.2 |
Protein Refseq | NP_001007524.1 |
UniProt ID | P23610 |
◆ Recombinant Proteins | ||
F8A2-956H | Recombinant Human F8A2 Protein, MYC/DDK-tagged | +Inquiry |
F8A2-884H | Recombinant Human F8A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
F8A2-1753HFL | Recombinant Full Length Human F8A2 Protein, C-Flag-tagged | +Inquiry |
F8A2-1395H | Recombinant Human F8A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F8A2 Products
Required fields are marked with *
My Review for All F8A2 Products
Required fields are marked with *
0
Inquiry Basket