Recombinant Full Length Human FABP7 Protein, GST-tagged
Cat.No. : | FABP7-4428HF |
Product Overview : | Human FABP7 full-length ORF ( AAH12299, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 132 amino acids |
Description : | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 40.26 kDa |
AA Sequence : | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FABP7 fatty acid binding protein 7, brain [ Homo sapiens ] |
Official Symbol | FABP7 |
Synonyms | FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313; |
Gene ID | 2173 |
mRNA Refseq | NM_001446 |
Protein Refseq | NP_001437 |
MIM | 602965 |
UniProt ID | O15540 |
◆ Recombinant Proteins | ||
FABP7-370H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
FABP7-8553H | Recombinant Human FABP7, None tagged | +Inquiry |
FABP7-26319TH | Recombinant Human FABP7 | +Inquiry |
FABP7-1538R | Recombinant Rhesus monkey FABP7 Protein, His-tagged | +Inquiry |
FABP7-02H | Recombinant Human FABP7 Protein, GFP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP7 Products
Required fields are marked with *
My Review for All FABP7 Products
Required fields are marked with *