Recombinant Full Length Human FAF1 Protein, C-Flag-tagged
Cat.No. : | FAF1-1364HFL |
Product Overview : | Recombinant Full Length Human FAF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis initiated through FAS antigen. Initiation of apoptosis by the protein encoded by this gene requires a ubiquitin-like domain but not the FAS-binding domain. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.8 kDa |
AA Sequence : | MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPAS HPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKM LLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLN FSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEE QITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHP VFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQ QQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQA LPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPN KSLLEVKLFPQETLFLEAKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FAF1 Fas associated factor 1 [ Homo sapiens (human) ] |
Official Symbol | FAF1 |
Synonyms | hFAF1; CGI-03; HFAF1s; UBXD12; UBXN3A |
Gene ID | 11124 |
mRNA Refseq | NM_007051.3 |
Protein Refseq | NP_008982.1 |
MIM | 604460 |
UniProt ID | Q9UNN5 |
◆ Recombinant Proteins | ||
FAF1-2195R | Recombinant Rat FAF1 Protein | +Inquiry |
FAF1-3647H | Recombinant Human FAF1 Protein, GST-tagged | +Inquiry |
FAF1-4438HF | Recombinant Full Length Human FAF1 Protein, GST-tagged | +Inquiry |
FAF1-1366R | Recombinant Rhesus Macaque FAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAF1-12221Z | Recombinant Zebrafish FAF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAF1-6470HCL | Recombinant Human FAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAF1 Products
Required fields are marked with *
My Review for All FAF1 Products
Required fields are marked with *
0
Inquiry Basket