Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human FAHD1 Protein, GST-tagged

Cat.No. : FAHD1-4439HF
Product Overview : Human FAHD1 full-length ORF ( AAH20615.1, 1 a.a. - 47 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Tyrosine metabolism and Metabolism. GO annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 32.1 kDa
Protein Length : 47 amino acids
AA Sequence : MFQITFRCLPNFLRFGHHQEAFVKIKISTNYWPISDLLNQFDRINLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ]
Official Symbol : FAHD1
Synonyms : FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046;
Gene ID : 81889
mRNA Refseq : NM_001018104
Protein Refseq : NP_001018114
MIM : 616320
UniProt ID : Q6P587

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends