Recombinant Full Length Human FAHD1 Protein, GST-tagged
Cat.No. : | FAHD1-4439HF |
Product Overview : | Human FAHD1 full-length ORF ( AAH20615.1, 1 a.a. - 47 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 47 amino acids |
Description : | FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Tyrosine metabolism and Metabolism. GO annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MFQITFRCLPNFLRFGHHQEAFVKIKISTNYWPISDLLNQFDRINLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ] |
Official Symbol | FAHD1 |
Synonyms | FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046; |
Gene ID | 81889 |
mRNA Refseq | NM_001018104 |
Protein Refseq | NP_001018114 |
MIM | 616320 |
UniProt ID | Q6P587 |
◆ Recombinant Proteins | ||
FAHD1-5116C | Recombinant Chicken FAHD1 | +Inquiry |
FAHD1-1855R | Recombinant Rat FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAHD1-4439HF | Recombinant Full Length Human FAHD1 Protein, GST-tagged | +Inquiry |
FAHD1-958H | Recombinant Human FAHD1, His-tagged | +Inquiry |
FAHD1-2873Z | Recombinant Zebrafish FAHD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAHD1-250HCL | Recombinant Human FAHD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAHD1 Products
Required fields are marked with *
My Review for All FAHD1 Products
Required fields are marked with *