Recombinant Full Length Human FAHD1 Protein, GST-tagged

Cat.No. : FAHD1-4439HF
Product Overview : Human FAHD1 full-length ORF ( AAH20615.1, 1 a.a. - 47 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 47 amino acids
Description : FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Tyrosine metabolism and Metabolism. GO annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A.
Molecular Mass : 32.1 kDa
AA Sequence : MFQITFRCLPNFLRFGHHQEAFVKIKISTNYWPISDLLNQFDRINLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ]
Official Symbol FAHD1
Synonyms FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046;
Gene ID 81889
mRNA Refseq NM_001018104
Protein Refseq NP_001018114
MIM 616320
UniProt ID Q6P587

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAHD1 Products

Required fields are marked with *

My Review for All FAHD1 Products

Required fields are marked with *

0
cart-icon