Recombinant Full Length Human FAHD2A Protein, GST-tagged

Cat.No. : FAHD2A-4440HF
Product Overview : Human FAHD2A full-length ORF ( AAH09403.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 314 amino acids
Description : FAHD2A (Fumarylacetoacetate Hydrolase Domain Containing 2A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is FAHD2B.
Molecular Mass : 61 kDa
AA Sequence : MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAHD2A fumarylacetoacetate hydrolase domain containing 2A [ Homo sapiens ]
Official Symbol FAHD2A
Synonyms FAHD2A; fumarylacetoacetate hydrolase domain containing 2A; fumarylacetoacetate hydrolase domain-containing protein 2A; CGI 105; fumarylacetoacetate hydrolase domain containing 1; CGI-105; FLJ35661; MGC131995;
Gene ID 51011
mRNA Refseq NM_016044
Protein Refseq NP_057128
UniProt ID Q96GK7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAHD2A Products

Required fields are marked with *

My Review for All FAHD2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon