Recombinant Full Length Human FAIM2 Protein, GST-tagged

Cat.No. : FAIM2-4443HF
Product Overview : Human FAIM2 full-length ORF ( AAH00051, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 316 amino acids
Description : FAIM2 (Fas Apoptotic Inhibitory Molecule 2) is a Protein Coding gene. Among its related pathways are Dimerization of procaspase-8. An important paralog of this gene is TMBIM1.
Molecular Mass : 60.5 kDa
AA Sequence : MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAIM2 Fas apoptotic inhibitory molecule 2 [ Homo sapiens ]
Official Symbol FAIM2
Synonyms FAIM2; Fas apoptotic inhibitory molecule 2; protein lifeguard 2; KIAA0950; LFG; LFG2; LIFEGUARD; NMP35; TMBIM2; transmembrane BAX inhibitor motif containing 2; neural membrane protein 35; transmembrane BAX inhibitor motif-containing protein 2; NGP35;
Gene ID 23017
mRNA Refseq NM_012306
Protein Refseq NP_036438
MIM 604306
UniProt ID Q9BWQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAIM2 Products

Required fields are marked with *

My Review for All FAIM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon