Recombinant Full Length Human FAIM2 Protein, GST-tagged
Cat.No. : | FAIM2-4443HF |
Product Overview : | Human FAIM2 full-length ORF ( AAH00051, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 316 amino acids |
Description : | FAIM2 (Fas Apoptotic Inhibitory Molecule 2) is a Protein Coding gene. Among its related pathways are Dimerization of procaspase-8. An important paralog of this gene is TMBIM1. |
Molecular Mass : | 60.5 kDa |
AA Sequence : | MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAIM2 Fas apoptotic inhibitory molecule 2 [ Homo sapiens ] |
Official Symbol | FAIM2 |
Synonyms | FAIM2; Fas apoptotic inhibitory molecule 2; protein lifeguard 2; KIAA0950; LFG; LFG2; LIFEGUARD; NMP35; TMBIM2; transmembrane BAX inhibitor motif containing 2; neural membrane protein 35; transmembrane BAX inhibitor motif-containing protein 2; NGP35; |
Gene ID | 23017 |
mRNA Refseq | NM_012306 |
Protein Refseq | NP_036438 |
MIM | 604306 |
UniProt ID | Q9BWQ8 |
◆ Recombinant Proteins | ||
FAIM2-4443HF | Recombinant Full Length Human FAIM2 Protein, GST-tagged | +Inquiry |
FAIM2-2940M | Recombinant Mouse FAIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18108MF | Recombinant Full Length Mouse Protein Lifeguard 2(Faim2) Protein, His-Tagged | +Inquiry |
FAIM2-1858R | Recombinant Rat FAIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAIM2-5440M | Recombinant Mouse FAIM2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAIM2-6465HCL | Recombinant Human FAIM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAIM2 Products
Required fields are marked with *
My Review for All FAIM2 Products
Required fields are marked with *