Recombinant Full Length Human FAM107B Protein, GST-tagged

• Cat.No.: FAM107B-4462HF
• Product Overview: Human FAM107B full-length ORF ( ENSP00000367731, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 131 amino acids
• Description: FAM107B (Family With Sequence Similarity 107 Member B) is a Protein Coding gene. An important paralog of this gene is FAM107A.
• Molecular Mass: 42 kDa
• AA Sequence: MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM107B family with sequence similarity 107, member B [ Homo sapiens ]
• Official Symbol: FAM107B
• Synonyms: C10orf45; FAM107B; family with sequence similarity 107, member B; Family With Sequence Similarity 107 Member B; Heat Shock-Inducible Tumor Small Protein; Family With Sequence Similarity 107, Member B; Chromosome 10 Open Reading Frame 45; Protein FAM107B; HITS
• Gene ID: 83641
• mRNA Refseq: NM_031453
• Protein Refseq: NP_113641
• UniProt ID: Q9H098