Recombinant Full Length Human FAM107B Protein, GST-tagged
Cat.No. : | FAM107B-4462HF |
Product Overview : | Human FAM107B full-length ORF ( ENSP00000367731, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | FAM107B (Family With Sequence Similarity 107 Member B) is a Protein Coding gene. An important paralog of this gene is FAM107A. |
Molecular Mass : | 42 kDa |
AA Sequence : | MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM107B family with sequence similarity 107, member B [ Homo sapiens ] |
Official Symbol | FAM107B |
Synonyms | C10orf45; FAM107B; family with sequence similarity 107, member B; Family With Sequence Similarity 107 Member B; Heat Shock-Inducible Tumor Small Protein; Family With Sequence Similarity 107, Member B; Chromosome 10 Open Reading Frame 45; Protein FAM107B; HITS |
Gene ID | 83641 |
mRNA Refseq | NM_031453 |
Protein Refseq | NP_113641 |
UniProt ID | Q9H098 |
◆ Recombinant Proteins | ||
FAM107B-2949M | Recombinant Mouse FAM107B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM107B-2315H | Recombinant Human FAM107B, His-tagged | +Inquiry |
FAM107B-9831Z | Recombinant Zebrafish FAM107B | +Inquiry |
FAM107B-5452M | Recombinant Mouse FAM107B Protein | +Inquiry |
FAM107B-1863R | Recombinant Rat FAM107B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM107B Products
Required fields are marked with *
My Review for All FAM107B Products
Required fields are marked with *