Recombinant Full Length Human FAM129B Protein, GST-tagged

Cat.No. : FAM129B-4501HF
Product Overview : Human FAM129B full-length ORF ( AAH67366.1, 1 a.a. - 526 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 526 amino acids
Description : FAM129B (Family With Sequence Similarity 129 Member B) is a Protein Coding gene. Among its related pathways are MAP Kinase Signaling. An important paralog of this gene is FAM129A.
Molecular Mass : 87.1 kDa
AA Sequence : MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSVSSPHLLQPFGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM129B family with sequence similarity 129, member B [ Homo sapiens ]
Official Symbol FAM129B
Synonyms FAM129B; family with sequence similarity 129, member B; C9orf88, chromosome 9 open reading frame 88; niban-like protein 1; bA356B19.6; DKFZP434H0820; FLJ13518; FLJ22151; FLJ22298; MINERVA; melanoma invasion by ERK; OC58; MEG-3; C9orf88;
Gene ID 64855
mRNA Refseq NM_001035534
Protein Refseq NP_001030611
MIM 614045
UniProt ID Q96TA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM129B Products

Required fields are marked with *

My Review for All FAM129B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon