Recombinant Full Length Human FAM129B Protein, GST-tagged
Cat.No. : | FAM129B-4501HF |
Product Overview : | Human FAM129B full-length ORF ( AAH67366.1, 1 a.a. - 526 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 526 amino acids |
Description : | FAM129B (Family With Sequence Similarity 129 Member B) is a Protein Coding gene. Among its related pathways are MAP Kinase Signaling. An important paralog of this gene is FAM129A. |
Molecular Mass : | 87.1 kDa |
AA Sequence : | MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSVSSPHLLQPFGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM129B family with sequence similarity 129, member B [ Homo sapiens ] |
Official Symbol | FAM129B |
Synonyms | FAM129B; family with sequence similarity 129, member B; C9orf88, chromosome 9 open reading frame 88; niban-like protein 1; bA356B19.6; DKFZP434H0820; FLJ13518; FLJ22151; FLJ22298; MINERVA; melanoma invasion by ERK; OC58; MEG-3; C9orf88; |
Gene ID | 64855 |
mRNA Refseq | NM_001035534 |
Protein Refseq | NP_001030611 |
MIM | 614045 |
UniProt ID | Q96TA1 |
◆ Recombinant Proteins | ||
FAM129B-1873R | Recombinant Rat FAM129B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM129B-2216R | Recombinant Rat FAM129B Protein | +Inquiry |
FAM129B-1132H | Recombinant Human FAM129B Protein, MYC/DDK-tagged | +Inquiry |
FAM129B-3701H | Recombinant Human FAM129B Protein, GST-tagged | +Inquiry |
FAM129B-5488M | Recombinant Mouse FAM129B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM129B Products
Required fields are marked with *
My Review for All FAM129B Products
Required fields are marked with *
0
Inquiry Basket