Recombinant Full Length Human FAM136A Protein, GST-tagged
| Cat.No. : | FAM136A-4513HF |
| Product Overview : | Human FAM136A full-length ORF (BAB55208.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 138 amino acids |
| Description : | This gene encodes a mitochondrially localized protein that is highly conserved across species. The gene is expressed in a variety of tissues including human lymphoblast cells and rat neurosensorial epithelium of the cristaampullaris. A mutation in this gene has been associated with familial Meniere's disease, a chronic disorder of the inner ear. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016] |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | MAELQQLRVQEAMESMVKSLERENIRKMQGLMFRCSASCCEDSQAFMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM136A family with sequence similarity 136, member A [ Homo sapiens ] |
| Official Symbol | FAM136A |
| Synonyms | FAM136A; family with sequence similarity 136, member A; protein FAM136A; FLJ14668; hypothetical protein FLJ14668; |
| Gene ID | 84908 |
| mRNA Refseq | NM_032822 |
| Protein Refseq | NP_116211 |
| MIM | 616275 |
| UniProt ID | Q96C01 |
| ◆ Recombinant Proteins | ||
| FAM136A-3708H | Recombinant Human FAM136A Protein, GST-tagged | +Inquiry |
| FAM136A-2990M | Recombinant Mouse FAM136A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM136A-5500M | Recombinant Mouse FAM136A Protein | +Inquiry |
| Fam136a-2917M | Recombinant Mouse Fam136a Protein, Myc/DDK-tagged | +Inquiry |
| FAM136A-1877R | Recombinant Rat FAM136A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM136A-6424HCL | Recombinant Human FAM136A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM136A Products
Required fields are marked with *
My Review for All FAM136A Products
Required fields are marked with *
