Recombinant Full Length Human FAM163A Protein, C-Flag-tagged
Cat.No. : | FAM163A-2130HFL |
Product Overview : | Recombinant Full Length Human FAM163A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACSSQAL DGRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLA APQSYPVTWPGSGREAFTNPRAISTDV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | FAM163A family with sequence similarity 163 member A [ Homo sapiens (human) ] |
Official Symbol | FAM163A |
Synonyms | NDSP; C1orf76 |
Gene ID | 148753 |
mRNA Refseq | NM_173509.3 |
Protein Refseq | NP_775780.1 |
MIM | 611727 |
UniProt ID | Q96GL9 |
◆ Recombinant Proteins | ||
FAM163A-888H | Recombinant Human FAM163A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM163A-3717H | Recombinant Human FAM163A Protein, GST-tagged | +Inquiry |
FAM163A-4530HF | Recombinant Full Length Human FAM163A Protein, GST-tagged | +Inquiry |
FAM163A-4285H | Recombinant Human FAM163A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM163A-2130HFL | Recombinant Full Length Human FAM163A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM163A-6415HCL | Recombinant Human FAM163A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM163A Products
Required fields are marked with *
My Review for All FAM163A Products
Required fields are marked with *