Recombinant Full Length Human FAM19A5 Protein, GST-tagged

Cat.No. : FAM19A5-4547HF
Product Overview : Human FAM19A5 full-length ORF (BAG53905.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 125 amino acids
Description : This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines that act as regulators of immune and nervous cells. [provided by RefSeq, Sep 2013]
Molecular Mass : 40 kDa
AA Sequence : MQLLKALWALAGAALCCFLVLVIHAQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM19A5 family with sequence similarity 19 member A5, C-C motif chemokine like [ Homo sapiens (human) ]
Official Symbol FAM19A5
Synonyms FAM19A5; family with sequence similarity 19 member A5, C-C motif chemokine like; Family With Sequence Similarity 19 Member A5, C-C Motif Chemokine Like; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A5; Chemokine-Like Protein TAFA-5; TAFA5; Protein FAM19A5; TAFA Protein 5; QLLK5208; UNQ5208; TAFA-5; protein FAM19A5; TAFA protein 5; chemokine-like protein TAFA-5; family with sequence similarity 19 (chemokine (C-C motif)-like), member A5
Gene ID 25817
mRNA Refseq NM_001082967
Protein Refseq NP_001076436
MIM 617499
UniProt ID Q7Z5A7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM19A5 Products

Required fields are marked with *

My Review for All FAM19A5 Products

Required fields are marked with *

0
cart-icon
0
compare icon