Recombinant Full Length Human FAM204A Protein, GST-tagged
Cat.No. : | FAM204A-4550HF |
Product Overview : | Human FAM204A full-length ORF ( NP_071346.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 233 amino acids |
Description : | FAM204A (Family With Sequence Similarity 204 Member A) is a Protein Coding gene. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPIDMWNKFQELHKKHSEQKSTTSRFRGKRRKRSRKDKLKNEKELHSEPSSNETQWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQLATRELGVKIAKAVACHNFVKAKKEVENSQAARKKKKLAWGFEAKKRWETKSNMGYM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM204A family with sequence similarity 204, member A [ Homo sapiens ] |
Official Symbol | FAM204A |
Synonyms | C10orf84; bA319I23.1; RP11-319I23.1; FAM204A; family with sequence similarity 204, member A; Family With Sequence Similarity 204 Member A; Family With Sequence Similarity 204, Member A; Chromosome 10 Open Reading Frame 84; Protein FAM204A; BA319I23.1 |
Gene ID | 63877 |
mRNA Refseq | NM_022063 |
Protein Refseq | NP_071346 |
UniProt ID | Q9H8W3 |
◆ Recombinant Proteins | ||
FAM204A-1288H | Recombinant Human FAM204A Protein, His-tagged | +Inquiry |
FAM204A-3734H | Recombinant Human FAM204A Protein, GST-tagged | +Inquiry |
FAM204A-4550HF | Recombinant Full Length Human FAM204A Protein, GST-tagged | +Inquiry |
FAM204A-659Z | Recombinant Zebrafish FAM204A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM204A Products
Required fields are marked with *
My Review for All FAM204A Products
Required fields are marked with *
0
Inquiry Basket