Recombinant Full Length Human FAM204A Protein, GST-tagged

• Cat.No.: FAM204A-4550HF
• Product Overview: Human FAM204A full-length ORF ( NP_071346.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 233 amino acids
• Description: FAM204A (Family With Sequence Similarity 204 Member A) is a Protein Coding gene.
• Molecular Mass: 53.4 kDa
• AA Sequence: MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPIDMWNKFQELHKKHSEQKSTTSRFRGKRRKRSRKDKLKNEKELHSEPSSNETQWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQLATRELGVKIAKAVACHNFVKAKKEVENSQAARKKKKLAWGFEAKKRWETKSNMGYM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM204A family with sequence similarity 204, member A [ Homo sapiens ]
• Official Symbol: FAM204A
• Synonyms: C10orf84; bA319I23.1; RP11-319I23.1; FAM204A; family with sequence similarity 204, member A; Family With Sequence Similarity 204 Member A; Family With Sequence Similarity 204, Member A; Chromosome 10 Open Reading Frame 84; Protein FAM204A; BA319I23.1
• Gene ID: 63877
• mRNA Refseq: NM_022063
• Protein Refseq: NP_071346
• UniProt ID: Q9H8W3