Recombinant Full Length Human FAM226B Protein, GST-tagged

• Cat.No.: FAM226B-3507HF
• Product Overview: Human hCG_1731871 full-length ORF ( ABM85753.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 99 amino acids
• Description: FAM226B (Family With Sequence Similarity 226 Member B (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 37.29 kDa
• AA Sequence: MLKYVIKRYRSFLPEIFKKASDLPELVFGFYLKELDPAEHSYVLIRKIDPALVWGLTGDQGTPKTRLLMITLDSIFMQASCVPEEVVWEVLRVLEAHFV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM226B family with sequence similarity 226 member B (non-protein coding) [ Homo sapiens (human) ]
• Official Symbol: FAM226B
• Synonyms: FAM226B; family with sequence similarity 226 member B (non-protein coding); CXorf50B; LINC00246B; NCRNA00246B; hCG1731871; long intergenic non-protein coding RNA 246B; non-protein coding RNA 246B
• Gene ID: 653687