Recombinant Full Length Human FAM3C Protein, GST-tagged

Cat.No. : FAM3C-4586HF
Product Overview : Human FAM3C full-length ORF (AAH46932, 25 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 227 amino acids
Description : This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]
Molecular Mass : 48.07 kDa
AA Sequence : QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM3C family with sequence similarity 3, member C [ Homo sapiens ]
Official Symbol FAM3C
Synonyms FAM3C; family with sequence similarity 3, member C; protein FAM3C; GS3876; ILEI; interleukin like EMT inducer; predicted osteoblast protein; interleukin-like EMT inducer; GS3786;
Gene ID 10447
mRNA Refseq NM_001040020
Protein Refseq NP_001035109
MIM 608618
UniProt ID Q92520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM3C Products

Required fields are marked with *

My Review for All FAM3C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon