Recombinant Full Length Human FAM81A Protein, GST-tagged
| Cat.No. : | FAM81A-4640HF |
| Product Overview : | Human FAM81A full-length ORF ( NP_689663.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 365 amino acids |
| Description : | FAM81A (Family With Sequence Similarity 81 Member A) is a Protein Coding gene. An important paralog of this gene is FAM81B. |
| Molecular Mass : | 68.4 kDa |
| AA Sequence : | MHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVNSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSIRQVLEAKMKLDRDQLQKQIQLMQKPETPM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM81A family with sequence similarity 81, member A [ Homo sapiens ] |
| Official Symbol | FAM81A |
| Synonyms | FAM81A; family with sequence similarity 81, member A; protein FAM81A; MGC26690; |
| Gene ID | 145773 |
| mRNA Refseq | NM_152450 |
| Protein Refseq | NP_689663 |
| UniProt ID | Q8TBF8 |
| ◆ Recombinant Proteins | ||
| FAM81A-1453R | Recombinant Rhesus Macaque FAM81A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM81A-4640HF | Recombinant Full Length Human FAM81A Protein, GST-tagged | +Inquiry |
| FAM81A-3802H | Recombinant Human FAM81A Protein, GST-tagged | +Inquiry |
| FAM81A-3092M | Recombinant Mouse FAM81A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM81A-5644M | Recombinant Mouse FAM81A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM81A Products
Required fields are marked with *
My Review for All FAM81A Products
Required fields are marked with *
