Recombinant Full Length Human FAM96A Protein, GST-tagged
Cat.No. : | FAM96A-4654HF |
Product Overview : | Human FAM96A full-length ORF ( NP_115607.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 160 amino acids |
Description : | FAM96A (Family With Sequence Similarity 96 Member A) is a Protein Coding gene. An important paralog of this gene is FAM96B. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM96A family with sequence similarity 96, member A [ Homo sapiens ] |
Official Symbol | FAM96A |
Synonyms | FAM96A; family with sequence similarity 96, member A; Family With Sequence Similarity 96 Member A; Family With Sequence Similarity 96, Member A; MIP18 Family Protein FAM96A; CIA2A |
Gene ID | 84191 |
mRNA Refseq | NM_032231 |
Protein Refseq | NP_115607 |
MIM | 618382 |
UniProt ID | Q9H5X1 |
◆ Recombinant Proteins | ||
FAM96A-4654HF | Recombinant Full Length Human FAM96A Protein, GST-tagged | +Inquiry |
FAM96A-2269C | Recombinant Chicken FAM96A | +Inquiry |
FAM96A-12731H | Recombinant Human FAM96A, GST-tagged | +Inquiry |
FAM96A-3815H | Recombinant Human FAM96A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM96A-6338HCL | Recombinant Human FAM96A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM96A Products
Required fields are marked with *
My Review for All FAM96A Products
Required fields are marked with *
0
Inquiry Basket