Recombinant Full Length Human Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged
Cat.No. : | RFL15854HF |
Product Overview : | Recombinant Full Length Human Fatty acid desaturase 3(FADS3) Protein (Q9Y5Q0) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSR LIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQ AAEDMKLFDASPTFFAFLLGHILAMEVLAWLLIYLLGPGWVPSALAAFILAISQAQSWCL QHDLGHASIFKKSWWNHVAQKFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPV FLLGESSVEYGKKKRRYLPYNQQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWADLLWA ASFYARFFLSYLPFYGVPGVLLFFVAVRVLESHWFVWITQMNHIPKEIGHEKHRDWVSSQ LAATCNVEPSLFTNWFSGHLNFQIEHHLFPRMPRHNYSRVAPLVKSLCAKHGLSYEVKPF LTALVDIVRSLKKSGDIWLDAYLHQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FADS3 |
Synonyms | FADS3; CYB5RP; Fatty acid desaturase 3; Delta(13 fatty acid desaturase; Delta(13 desaturase |
UniProt ID | Q9Y5Q0 |
◆ Recombinant Proteins | ||
FADS3-1807H | Recombinant Human FADS3 protein, GST-tagged | +Inquiry |
FADS3-28818TH | Recombinant Human FADS3 | +Inquiry |
RFL6588RF | Recombinant Full Length Rat Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged | +Inquiry |
FADS3-2194R | Recombinant Rat FADS3 Protein | +Inquiry |
RFL15854HF | Recombinant Full Length Human Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADS3-6471HCL | Recombinant Human FADS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FADS3 Products
Required fields are marked with *
My Review for All FADS3 Products
Required fields are marked with *
0
Inquiry Basket