Recombinant Full Length Human FAU Protein

Cat.No. : FAU-163HF
Product Overview : Recombinant full length Human FAU with N-terminal proprietary tag, 40.37 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 133 amino acids
Description : This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin.
Form : Liquid
Molecular Mass : 40.370kDa inclusive of tags
AA Sequence : MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQV VLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSL ARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV PTFGKKKGPNANS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name FAU Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed [ Homo sapiens ]
Official Symbol FAU
Synonyms FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); ubiquitin-like protein fubi and ribosomal protein S30; asr1; FLJ22986; Fub1; Fubi
Gene ID 2197
mRNA Refseq NM_001997
Protein Refseq NP_001988
MIM 134690
UniProt ID P35544

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAU Products

Required fields are marked with *

My Review for All FAU Products

Required fields are marked with *

0
cart-icon